openaso

apps / 6786063532

ShriRamShalaka Prashnawali

Reference

Amit Kumar Srivastava · Reference · $4.99 · US storefront

rating
5.0 ★
ratings
1
updated
Jul 9, 2026

v1.0

released
Jul 9, 2026

visible word pool · 3 words

shriramshalakaprashnawalireference

title 26/30 chars · subtitle 9/30 chars

App Store search indexes the title and subtitle together with the hidden 100-character keyword field as one combined pool: any phrase assembled from those words can rank. These are the words of ShriRamShalaka Prashnawali's pool that are public — the keyword field is not exposed by any API.

from the listing

Ram Shalaka is a traditional devotional question-and-answer method based on the revered epic Shri Ramcharitmanas composed by Goswami Tulsidas. In this app tried to place the letters correctly and the traditional meaning of it. This application allows users to seek spiritual guidance through the traditional Ram Shalaka Prashnavali. The original Hindi verses of Shri Ramcharitmanas are part of the public domain. The English translations, explanations, application design, user…

full listing on the App Store ↗

Where does it rank? Chart position is one signal — most installs come from keyword search. Check where ShriRamShalaka Prashnawali ranks for any keyword, free, with the rank checker.

this page is one tool call

mcp · app
{
  "tool": "app",
  "arguments": {
    "appId": 6786063532,
    "countries": [
      "US"
    ],
    "subtitle": true
  }
}

The app tool returns this listing as stable JSON for any storefront — one of thirteen ASO tools your agent gets over MCP. Get a free key.

nearby on top free reference apps

full top free reference apps chart →